α-Bungarotoxin

(HB2038)

Product overview

  • Name
    α-Bungarotoxin
  • Short description
    α7 subtype selective nAChR antagonist
  • Biological description

    Irreversible, high affinity nicotinic acethylcholine receptor (nAChR) antagonist. Neurotoxin. Shows subtype selectivity for α7 over α3β4 receptors.

    Shows activity at the heteromeric muscle receptors (αβγδ or αβδε subunits) and neuronal subtypes (α7, α8, α9 subunits, (IC50 values are 1.6 nM and > 3 μM respectively).

    Prevents opening of nicotinic receptor-associated ion channels and blocks neuromuscular transmission. Additionally acts as an imaging tool for fluorophore- labeling studies.

  • Alternative names
    α-BTX, α-Bgtx, α-BuTX, BGT
  • Biological action
    Antagonist
  • Purity
    >99%
  • Our products in action

Properties

  • Chemical name
    IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
  • Molecular Weight
    7984
  • Molecular Formula
    C338H529N97O105S11
  • CAS Number
    11032-79-4
  • Source
    Bungarus multicinctus

Storing and Using Your Product

  • Storage instructions
    -20°C (dessicate)
  • Solubility overview
    Soluble in water
  • Important
    This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use.

References for α-Bungarotoxin

  • Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors.

    Hannan et al (2015) Neuropharmacology 93 : 28-40
    PubMedID: 25634239
  • Inter-residue coupling contributes to high-affinity subtype-selective binding of α-bungarotoxin to nicotinic receptors.

    Sine et al (2013) Biochem J 454(2) : 311-21
    PubMedID: 23802200
  • Neuronal acetylcholine receptors that bind alpha-bungarotoxin with high affinity function as ligand-gated ion channels.

    Zhang et al (1994) Neuron 12(1) : 167-77
    PubMedID: 7507338
  • Identification of regions involved in the binding of alpha-bungarotoxin to the human alpha7 neuronal nicotinic acetylcholine receptor using synthetic peptides.

    Marinou et al (12614199) Biochem J 372 : 543-54
    PubMedID: 12614199

Reviews & Product Guides