In my cart

You have no items in your shopping cart.

Neuropeptide Y (human,rat)

(HB2935)
Data

Product overview

  • Name
    Neuropeptide Y (human,rat)
  • Short description
    Widely distributed endogenous neuropeptide
  • Biological description

    Neuropeptide Y (NPY) is a 36-amino acid endogenous neuropeptide which is involved in a variety of physiological and homeostatic processes. It is widely distributed in the CNS and is one of the most abundant peptides found in the brain. It is also distributed in the PNS.


     The NPY neuropeptide is active in vivo and has been shown to be involved in obesity and food intake, stress, anxiety, depression, epilepsy, pain, neurodegeneration and cardiovascular regulation.

    NPY is a potent orexigenic peptide which stimulates food intake.

  • Alternative names
    NPY
  • Biological action
    Activator
  • Citations

Properties

  • Chemical name
    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide)
  • Molecular Weight
    4271.75
  • Chemical structure
    Neuropeptide Y (human,rat) [90880-35-6]
  • Molecular Formula
    C189H285N55O57S
  • Sequence (one letter)
    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Sequence (three letter)
    Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
  • Modifications
    Modifications: Tyr-36 = C-terminal amide
  • CAS Number
    90880-35-6
  • PubChem identifier
    24868177
  • SMILES
    CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CN=CN3)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CC5=CC=C(C=C5)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]6CCCN6C(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]7CCCN7C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]8CCCN8C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]9CCCN9C(=O)[C@H](CC1=CC=C(C=C1)O)N
  • InChiKey
    XKWCTHKJQNUFOQ-HRPSIEBRSA-N
  • MDL number
    MFCD00212432
  • Protein length
    36

Storing and Using Your Product

  • Storage instructions
    Desiccate at -20°C
  • Solubility overview
    Soluble in water (1.5 mg/ml)
  • Important
    This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

References for Neuropeptide Y (human,rat)

  • Neuropeptide Y: an overview of central distribution, functional aspects, and possible involvement in neuropsychiatric illnesses.

    Heilig et al (1990) Acta Psychiatr Scand. 82(2) : 95-114
    PubMedID: 2173355
  • Neuropeptide Y in normal eating and in genetic and dietary-induced obesity.

    Beck B, (2006) Philos Trans R Soc Lond B Biol Sci. 361(1471) : 1159-85
    PubMedID: 16874931
  • Neuropeptide Y: some viewpoints on a multifaceted peptide in the normal and diseased nervous system.

    Hokfelt et al (1998) Brain Res 26(2-3) : 154-66
    PubMedID: 9651513
Support & Resources

Reviews & Product Guides